Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EWSR1 Peptide - middle region

EWSR1 Peptide - middle region

Product Specifications

Product Name Alternative

EWS, EWS-FLI1, bK984G1.4

UniProt

Q01844

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001156757.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PER2 Antibody
RC-16685-01 50 μL

Recombinant PER2 Antibody

Sign In for Pricing
View Details
Recombinant PER2 Antibody
RC-16685-02 100 µL

Recombinant PER2 Antibody

Sign In for Pricing
View Details
Recombinant PER2 Antibody
RC-16685-03 1 mL

Recombinant PER2 Antibody

Sign In for Pricing
View Details
IKK alpha Recombinant Rabbit Monoclonal Antibody [SN06-99]
ET1611-15 100 µL

IKK alpha Recombinant Rabbit Monoclonal Antibody [SN06-99]

Sign In for Pricing
View Details
Niflumic Acid-d5 (Major)
TRC-N457502-1MG 1 mg

Niflumic Acid-d5 (Major)

Sign In for Pricing
View Details
TAF1 48 (TAF1A) Mouse Monoclonal Antibody [Clone ID: OTI7A11]
CF811372 100 µg

TAF1 48 (TAF1A) Mouse Monoclonal Antibody [Clone ID: OTI7A11]

Sign In for Pricing
View Details