Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCL1 Peptide - middle region

MCL1 Peptide - middle region

Product Specifications

Product Name Alternative

TM, EAT, MCL1L, MCL1S, Mcl-1, BCL2L3, MCL1-ES, bcl2-L-3, mcl1/EAT

UniProt

Q07820

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001184249.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (KRT7/2200), CF647 conjugate, 0.1mg/mL
BNC472200-100 1x 100 µL

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (KRT7/2200), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p53 (TP53) Mouse Monoclonal Antibody [Clone ID: SPM590]
AM50178PU-S 100 µg

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: SPM590]

Sign In for Pricing
View Details
H3FA (HIST1H3A) Rabbit Polyclonal Antibody
AP06169PU-N 100 µg

H3FA (HIST1H3A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AMPK alpha 1 (PRKAA1) Human Gene Knockout Kit (CRISPR)
KN218572BN 1 Kit

AMPK alpha 1 (PRKAA1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
E3 SUMO protein ligase PIAS4 (PIAS4) (C-term) Rabbit Polyclonal Antibody
AP11254PU-N 400 µL

E3 SUMO protein ligase PIAS4 (PIAS4) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PHD4 (P4HTM) activation kit by CRISPRa
GA110220 1 Kit

Human PHD4 (P4HTM) activation kit by CRISPRa

Sign In for Pricing
View Details