MCL1 Peptide - middle region
MCL1 Peptide - middle region
Product Specifications
Product Name Alternative
TM, EAT, MCL1L, MCL1S, Mcl-1, BCL2L3, MCL1-ES, bcl2-L-3, mcl1/EAT
UniProt
Q07820
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001184249.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHET
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GP-6301-5 1 mL
Colloidal Gold Conjugated Artocarpus integrifolia Lectin (Jackfruit) -Jacalin, AIA-, 5nm
Sign In for Pricing
View Details 
BNC743491-500 1x 500 µL
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3491), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 