Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE4A Peptide - middle region

PDE4A Peptide - middle region

Product Specifications

Product Name Alternative

PDE4, DPDE2, PDE46

UniProt

P27815

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001104777.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDNRDWYYSAIRQSPSPPPEEESRGPGHPPLPDKFQFELTLEEEEEEEIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hgd (NM_013547) Mouse Tagged Lenti ORF Clone
MR207095L3 10 µg

Hgd (NM_013547) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
LOC100125384 Rat shRNA Plasmid (Locus ID 100125384)
TR704295 1 Kit

LOC100125384 Rat shRNA Plasmid (Locus ID 100125384)

Sign In for Pricing
View Details
TXNRD3, ID (TXNRD3, TGR, TRXR3, Thioredoxin reductase 3, Thioredoxin and glutathione reductase, Thioredoxin reductase TR2) (Biotin) discontinued
043486-Biotin 200 µL

TXNRD3, ID (TXNRD3, TGR, TRXR3, Thioredoxin reductase 3, Thioredoxin and glutathione reductase, Thioredoxin reductase TR2) (Biotin) discontinued

Sign In for Pricing
View Details
Tbl3 Rat shRNA Plasmid (Locus ID 287120)
TL700951 1 Kit

Tbl3 Rat shRNA Plasmid (Locus ID 287120)

Sign In for Pricing
View Details
Recombinant mouse Asparagine Synthetase/ASNS protein
ATGP3908-100 100 µg

Recombinant mouse Asparagine Synthetase/ASNS protein

Sign In for Pricing
View Details
ATE1 Adenovirus (Mouse)
12605054 1.0 mL

ATE1 Adenovirus (Mouse)

Sign In for Pricing
View Details