Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDG Peptide - middle region

TDG Peptide - middle region

Product Specifications

Product Name Alternative

HTDG

UniProt

Q13569

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003202.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLCO1A2 (NM_021094) Human Tagged Lenti ORF Clone
RC220849L2 10 µg

SLCO1A2 (NM_021094) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Bovine Cytochrome b5 (CYB5A)
MBS955304 Inquire

Recombinant Bovine Cytochrome b5 (CYB5A)

Sign In for Pricing
View Details
Rgs14 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
39471116 3x 1.0 µg

Rgs14 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
6-Hydroxy-5-nitronicotinic acid
TRC-H950838-5G 5 g

6-Hydroxy-5-nitronicotinic acid

Sign In for Pricing
View Details
PSG1 Rabbit pAb
A13533 50 µL

PSG1 Rabbit pAb

Sign In for Pricing
View Details
Anti-AKR1C3 Antibody Picoband® (Dylight488 Conjugate)
A01820-1-Dylight488 100 µg

Anti-AKR1C3 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details