TDG Peptide - middle region
TDG Peptide - middle region
Product Specifications
Product Name Alternative
HTDG
UniProt
Q13569
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_003202.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7280182-01 48 Well
Porcine Protein Wnt Family Member 16 ELISA Kit
Sign In for Pricing
View Details MBS7280182-02 96 Well
Porcine Protein Wnt Family Member 16 ELISA Kit
Sign In for Pricing
View Details MBS7280182-03 5x 96 Well
Porcine Protein Wnt Family Member 16 ELISA Kit
Sign In for Pricing
View Details MBS7280182-04 10x 96 Well
Porcine Protein Wnt Family Member 16 ELISA Kit
Sign In for Pricing
View Details 
MBS1336064-01 0.5 mg (E-Coli)
Recombinant Pelodictyon luteolum ATP synthase subunit b 1 (atpF1), partial
Sign In for Pricing
View Details