Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF5A Peptide - middle region

EIF5A Peptide - middle region

Product Specifications

Product Name Alternative

EIF-5A, EIF5A1, eIF5AI

UniProt

P63241

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001137232.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EPOR & CD131 Heterodimer HEK293 Overexpression Lysate
MBS8118064-01 0.3 mg

Human EPOR & CD131 Heterodimer HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Human EPOR & CD131 Heterodimer HEK293 Overexpression Lysate
MBS8118064-02 5x 0.3 mg

Human EPOR & CD131 Heterodimer HEK293 Overexpression Lysate

Sign In for Pricing
View Details
DBT Rabbit pAb
A20381-01 20 µL

DBT Rabbit pAb

Sign In for Pricing
View Details
DBT Rabbit pAb
A20381-02 100 μL

DBT Rabbit pAb

Sign In for Pricing
View Details
DBT Rabbit pAb
A20381-03 500 μL

DBT Rabbit pAb

Sign In for Pricing
View Details
DBT Rabbit pAb
A20381-04 1000 μL

DBT Rabbit pAb

Sign In for Pricing
View Details