Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF5A Peptide - middle region

EIF5A Peptide - middle region

Product Specifications

Product Name Alternative

EIF-5A, EIF5A1, eIF5AI

UniProt

P63241

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001137232.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat cystathionine β synthase (CBS) ELISA Kit
GTR10352244 96 Well

Goat cystathionine β synthase (CBS) ELISA Kit

Sign In for Pricing
View Details
Human KRT74 shRNA Plasmid
abx964671-01 150 µg

Human KRT74 shRNA Plasmid

Sign In for Pricing
View Details
Human KRT74 shRNA Plasmid
abx964671-02 300 µg

Human KRT74 shRNA Plasmid

Sign In for Pricing
View Details
LPCAT2 polyclonal antibody
BS62313-01 50 µL

LPCAT2 polyclonal antibody

Sign In for Pricing
View Details
LPCAT2 polyclonal antibody
BS62313-02 100 µL

LPCAT2 polyclonal antibody

Sign In for Pricing
View Details
Isobutyl Acrylate (stabilized with MEHQ)
OR1078317-01 25 mL

Isobutyl Acrylate (stabilized with MEHQ)

Sign In for Pricing
View Details