Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YBX3 Peptide - middle region

YBX3 Peptide - middle region

Product Specifications

Product Name Alternative

CSDA, DBPA, CSDA1, ZONAB

UniProt

P16989

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138898.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF300P1 Human qPCR Primer Pair
HP220967 200 Reactions

ZNF300P1 Human qPCR Primer Pair

Sign In for Pricing
View Details
BTK Human Gene Knockout Kit (CRISPR)
KN211582BN 1 Kit

BTK Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Seladin 1 (DHCR24) (NM_014762) Human Over-expression Lysate
LC402373 20 µg

Seladin 1 (DHCR24) (NM_014762) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR559109 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Recombinant Human FLT3LG/Flt3 Ligand Protein (His Tag)
PKSH032452-01 10 µg

Recombinant Human FLT3LG/Flt3 Ligand Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human FLT3LG/Flt3 Ligand Protein (His Tag)
PKSH032452-02 50 µg

Recombinant Human FLT3LG/Flt3 Ligand Protein (His Tag)

Sign In for Pricing
View Details