Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YBX3 Peptide - middle region

YBX3 Peptide - middle region

Product Specifications

Product Name Alternative

CSDA, DBPA, CSDA1, ZONAB

UniProt

P16989

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138898.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLIP (CFLAR) (NM_001127184) Human Recombinant Protein
TP325270 20 µg

FLIP (CFLAR) (NM_001127184) Human Recombinant Protein

Sign In for Pricing
View Details
Hbb-b2 (BC032264) Mouse Over-expression Lysate
LC700989 20 µg

Hbb-b2 (BC032264) Mouse Over-expression Lysate

Sign In for Pricing
View Details
Carburetor Ultrasonic BULC-607
BULC-607 1 Unit

Carburetor Ultrasonic BULC-607

Sign In for Pricing
View Details
TBX3 Rabbit Polyclonal Antibody
TA371791 100 µL

TBX3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CPM Antibody
8C14962-AAT 50 µg

CPM Antibody

Sign In for Pricing
View Details
dl-Alpha-Tocopherol Acetate
TRC-T526155-1G 1 g

dl-Alpha-Tocopherol Acetate

Sign In for Pricing
View Details