Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRPC7 Peptide - C-terminal region

TRPC7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRP7

UniProt

Q9HCX4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001161048.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNLNKDHLRVNKGKDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (DCS-72.F6), CF640R conjugate, 0.1mg/mL
BNC400771-500 1x 500 µL

P27 / KIP1 (DCS-72.F6), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL
BNC940965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXJ3 Antibody
KC-1631-01 50 μL

FOXJ3 Antibody

Sign In for Pricing
View Details
FOXJ3 Antibody
KC-1631-02 100 µL

FOXJ3 Antibody

Sign In for Pricing
View Details
FOXJ3 Antibody
KC-1631-03 1 mL

FOXJ3 Antibody

Sign In for Pricing
View Details
Mouse Atp1b1 activation kit by CRISPRa
GA200316 1 Kit

Mouse Atp1b1 activation kit by CRISPRa

Sign In for Pricing
View Details