Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRPC7 Peptide - C-terminal region

TRPC7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRP7

UniProt

Q9HCX4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001161048.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNLNKDHLRVNKGKDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (115D8), 0.2mg/mL
BNUB0612-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (115D8), 0.2mg/mL

Sign In for Pricing
View Details
CDw75 (LN-1), 0.2mg/mL
BNUB0055-100 1x 100 µL

CDw75 (LN-1), 0.2mg/mL

Sign In for Pricing
View Details
(S)-(-)-2-Amino-3-Benzyloxy-1-Propanol
TRC-A600200-5G 5 g

(S)-(-)-2-Amino-3-Benzyloxy-1-Propanol

Sign In for Pricing
View Details
NRF1 (NRF1/2609), 0.2mg/mL
BNUB2609-500 1x 500 µL

NRF1 (NRF1/2609), 0.2mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS803693 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
TBXAS1 (NM_001130966) Human Over-expression Lysate
LC427328 20 µg

TBXAS1 (NM_001130966) Human Over-expression Lysate

Sign In for Pricing
View Details