Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBLC Peptide - C-terminal region

CBLC Peptide - C-terminal region

Product Specifications

Product Name Alternative

CBL-3, RNF57, CBL-SL

UniProt

Q9ULV8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001124324.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SIYQFHGQATAEDSGNSSDQEGRELELGQVPLSAPPLPPRPDLPPRKPRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISCU Rabbit Polyclonal Antibody
TA370302 100 µL

ISCU Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AKAP11 Human Gene Knockout Kit (CRISPR)
KN420532 1 Kit

AKAP11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human PPP1R3F activation kit by CRISPRa
GA113934 1 Kit

Human PPP1R3F activation kit by CRISPRa

Sign In for Pricing
View Details
cIAP2 (BIRC3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B2]
TA800041AM 100 µL

cIAP2 (BIRC3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B2]

Sign In for Pricing
View Details
TTC39A Human Gene Knockout Kit (CRISPR)
KN418567 1 Kit

TTC39A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cy3.5 Dye qPCR Calibration Plate *Optimized for ABI7500 Fast 96-Well*
67014-AAT 1 Plate

Cy3.5 Dye qPCR Calibration Plate *Optimized for ABI7500 Fast 96-Well*

Sign In for Pricing
View Details