What is the catalog number for GNL3 Peptide - C-terminal region?

The catalog number for GNL3 Peptide - C-terminal region is orb1998285.

What sizes are available for GNL3 Peptide - C-terminal region?

GNL3 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is GNL3 Peptide - C-terminal region in stock?

GNL3 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

GNL3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NS, E2IG3, NNP47, C77032

UniProt

Q9BVP2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055181.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFQSSGLTNGIIEEKDIHEELPKRKERKQEEREDDKDSDQETVDEEVDEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb2097957 100 µL

ADRA1A Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing

View Details

K6030401 3x 1.0 µg

Cog8 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing

View Details

RDR-aFP-p-01 48T

Porcine Alpha-Fetoprotein (aFP) ELISA Kit

Sign In for Pricing

View Details

RDR-aFP-p-02 96T

Porcine Alpha-Fetoprotein (aFP) ELISA Kit

Sign In for Pricing

View Details

ABD5162 100 µg

TAS2R48 Antibody

Sign In for Pricing

View Details

28461066 1.0 µg DNA

MFSD7 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing

View Details