Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNL3 Peptide - C-terminal region

GNL3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NS, E2IG3, NNP47, C77032

UniProt

Q9BVP2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055181.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFQSSGLTNGIIEEKDIHEELPKRKERKQEEREDDKDSDQETVDEEVDEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Golga1 Rat shRNA Plasmid (Locus ID 311919)
TL706391 1 Kit

Golga1 Rat shRNA Plasmid (Locus ID 311919)

Sign In for Pricing
View Details
ATP5MJ Rabbit Polyclonal Antibody
TA367901 100 µL

ATP5MJ Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Goat IL-10Ra ELISA Kit
GTR10324314 96 Well

Goat IL-10Ra ELISA Kit

Sign In for Pricing
View Details
Ric3 (NM_178780) Mouse Tagged ORF Clone Lentiviral Particle
MR225822L3V 200 µL

Ric3 (NM_178780) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Pcdhga6 Mouse Gene Knockout Kit (CRISPR)
KN512931 1 Kit

Pcdhga6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TNFSF11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2417406 1.0 µg DNA

TNFSF11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details