Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDM4A Peptide - middle region

KDM4A Peptide - middle region

Product Specifications

Product Name Alternative

JMJD2, JHDM3A, JMJD2A, TDRD14A

UniProt

O75164

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055478.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AEVADEYMFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TDH Protein Vector (Human) (pPM-C-HA)
PV135288 500 ng

TDH Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CRTAC1 Polyclonal Antibody
MBS9433004-01 0.05 mL

CRTAC1 Polyclonal Antibody

Sign In for Pricing
View Details
CRTAC1 Polyclonal Antibody
MBS9433004-02 0.1 mL

CRTAC1 Polyclonal Antibody

Sign In for Pricing
View Details
CRTAC1 Polyclonal Antibody
MBS9433004-03 5x 0.1 mL

CRTAC1 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF101 antibody
FNab09653 100 µg

ZNF101 antibody

Sign In for Pricing
View Details
CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4) (MaxLight 490) discontinued
C2404-46M1-ML490 100 µL

CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4) (MaxLight 490) discontinued

Sign In for Pricing
View Details