KDM4A Peptide - middle region
KDM4A Peptide - middle region
Product Specifications
Product Name Alternative
JMJD2, JHDM3A, JMJD2A, TDRD14A
UniProt
O75164
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_055478.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AEVADEYMFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
244790-ML405 100 µL
CNAP1 (non-SMC Condensin I Complex, Subunit D2, CAP-D2, CNAP1, KIAA0159, hCAP-D2) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
MBS6122625-01 0.1 mL
CD11b (CD11 antigen-like family member B, CD11b/CD18, CD49d, Cell surface glycoprotein MAC-1 subunit alpha, Complement Component Receptor 3 Alpha, CR3 Alpha Chain (CR3A), Integrin alpha-M, Integrin beta 2 alpha subunit, ITGAM, Leukocyte adhesion receptor
Sign In for Pricing
View Details MBS6122625-02 5x 0.1 mL
CD11b (CD11 antigen-like family member B, CD11b/CD18, CD49d, Cell surface glycoprotein MAC-1 subunit alpha, Complement Component Receptor 3 Alpha, CR3 Alpha Chain (CR3A), Integrin alpha-M, Integrin beta 2 alpha subunit, ITGAM, Leukocyte adhesion receptor
Sign In for Pricing
View Details MBS453086-01 48 Tests
Human GLI Family Zinc Finger Protein 1 (GLI1) ELISA Kit
Sign In for Pricing
View Details MBS453086-02 96 Tests
Human GLI Family Zinc Finger Protein 1 (GLI1) ELISA Kit
Sign In for Pricing
View Details MBS453086-03 5x 96 Tests
Human GLI Family Zinc Finger Protein 1 (GLI1) ELISA Kit
Sign In for Pricing
View Details