Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCK1 Peptide - N-terminal region

NCK1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NCK, nck-1, NCKalpha

UniProt

P16333

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001177725.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARKASIVKNLKDTLGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-500 1x 500 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF405S conjugate, 0.1mg/mL
BNC040345-100 1x 100 µL

CD4 (EDU-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF647 conjugate, 0.1mg/mL
BNC470342-500 1x 500 µL

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PCRP-TP53-1F7), CF568 conjugate, 0.1mg/mL
BNC681925-100 1x 100 µL

P53 Tumor Suppressor Protein (PCRP-TP53-1F7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (DE-K18), CF594 conjugate, 0.1mg/mL
BNC940563-100 1x 100 µL

Cytokeratin 18 (DE-K18), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/520), CF405S conjugate, 0.1mg/mL
BNC040520-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/520), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details