What is the catalog number for DYRK2 Peptide - middle region?

The catalog number for DYRK2 Peptide - middle region is orb1998280.

What sizes are available for DYRK2 Peptide - middle region?

DYRK2 Peptide - middle region is available in the following size(s): 100 µg.

Is DYRK2 Peptide - middle region in stock?

DYRK2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

DYRK2 Peptide - middle region

Product Specifications

UniProt

Q92630

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003574.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS1107208 Inquire

Recombinant Yersinia pseudotuberculosis serotype IB UPF0299 membrane protein YPTS_1639 (YPTS_1639)

Sign In for Pricing

View Details

NBP3-11458V 0.1 mL

Mouse Monoclonal MUC5AC Antibody (CLH2) [DyLight 405]

Sign In for Pricing

View Details

LV621200 1.0 µg DNA

IFI44 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing

View Details

orb3010030-01 20 µg

Recombinant Human Angiopoietin-1 receptor (TIE2), partial

Sign In for Pricing

View Details

orb3010030-02 100 µg

Recombinant Human Angiopoietin-1 receptor (TIE2), partial

Sign In for Pricing

View Details

orb3010030-03 1 mg

Recombinant Human Angiopoietin-1 receptor (TIE2), partial

Sign In for Pricing

View Details