DYRK2 Peptide - middle region
DYRK2 Peptide - middle region
Product Specifications
UniProt
Q92630
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_003574.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ABC-X0486 1 Vial
Xpress™ Human CASC4 Over-expressing Stable Cell Line
Sign In for Pricing
View Details 
sc-415471-ACT-2 20 µg
Histone cluster 2 H2AB CRISPR Activation Plasmid (h2)
Sign In for Pricing
View Details 
196167 Box of 1 Piece(s)
CS NW RFID 1 user-Online SUBS New AE Software
Sign In for Pricing
View Details