KMT5A Peptide - middle region
KMT5A Peptide - middle region
Product Specifications
Product Name Alternative
SET8, SET07, SETD8, PR-Set7
UniProt
Q9NQR1
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_065115.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Lsx4758-1mgEcoli 1 mg (E. coli)
Recombinant Bordetella Petrii psd Protein (aa 1-253)
Sign In for Pricing
View Details TRV-0052025-01 24 Tests
CLIA Kit for Granulocyte Chemotactic Protein 2 (GCP2)
Sign In for Pricing
View Details TRV-0052025-02 48 Tests
CLIA Kit for Granulocyte Chemotactic Protein 2 (GCP2)
Sign In for Pricing
View Details TRV-0052025-03 96 Tests
CLIA Kit for Granulocyte Chemotactic Protein 2 (GCP2)
Sign In for Pricing
View Details TRV-0052025-04 5x 96 Tests
CLIA Kit for Granulocyte Chemotactic Protein 2 (GCP2)
Sign In for Pricing
View Details