Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KMT5A Peptide - middle region

KMT5A Peptide - middle region

Product Specifications

Product Name Alternative

SET8, SET07, SETD8, PR-Set7

UniProt

Q9NQR1

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_065115.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tatdn3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3086705 3x 1.0 µg

Tatdn3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
PLAC1 Protein Vector (Rat) (pPB-N-His)
PV294383 500 ng

PLAC1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Monkey Midkine ELISA Kit
MBS046639-01 48 Well

Monkey Midkine ELISA Kit

Sign In for Pricing
View Details
Monkey Midkine ELISA Kit
MBS046639-02 96 Well

Monkey Midkine ELISA Kit

Sign In for Pricing
View Details
Monkey Midkine ELISA Kit
MBS046639-03 5x 96 Well

Monkey Midkine ELISA Kit

Sign In for Pricing
View Details
Monkey Midkine ELISA Kit
MBS046639-04 10x 96 Well

Monkey Midkine ELISA Kit

Sign In for Pricing
View Details