Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FRG1 Peptide - middle region

FRG1 Peptide - middle region

Product Specifications

Product Name Alternative

FSG1, FRG1A

UniProt

Q14331

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004468.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WWTVTNFGEISGTIAIEMDKGTYIHALDNGLFTLGAPHKEVDEGPSPPEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat TSC1 (Phospho-Y297) Blocking peptide
orb1441190 500 µg

Rat TSC1 (Phospho-Y297) Blocking peptide

Sign In for Pricing
View Details
Bcl 3 (B Cell CLL/lymphoma 3, B Cell Leukemia 3, B Cell Leukemia/lymphoma 3, B Cell Lymphoma 3 Encoded Protein, BCL3, BCL4, Chronic Lymphatic Leukemia Protein, D19S37, Protein Bcl 3) (MaxLight 750) discontinued
B0807-10G-ML750 100 µL

Bcl 3 (B Cell CLL/lymphoma 3, B Cell Leukemia 3, B Cell Leukemia/lymphoma 3, B Cell Lymphoma 3 Encoded Protein, BCL3, BCL4, Chronic Lymphatic Leukemia Protein, D19S37, Protein Bcl 3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
ACPL2-set siRNA/shRNA/RNAi Lentivector (Human)
11203091 4x 500 ng

ACPL2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
(2S,3R,4S,5R) -4- ((2,4-Dichlorobenzyl) oxy) -5- (((2,4-dichlorobenzyl) oxy) methyl) -2-methoxytetrahydrofuran-3-ol
OR1051189 100 mg

(2S,3R,4S,5R) -4- ((2,4-Dichlorobenzyl) oxy) -5- (((2,4-dichlorobenzyl) oxy) methyl) -2-methoxytetrahydrofuran-3-ol

Sign In for Pricing
View Details
Red APC Mab (Rat APC Mab)
HP8 1 Each

Red APC Mab (Rat APC Mab)

Sign In for Pricing
View Details
Cytokine-Like 1 Human Recombinant
rAP-0717 1 Each

Cytokine-Like 1 Human Recombinant

Sign In for Pricing
View Details