Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FRG1 Peptide - middle region

FRG1 Peptide - middle region

Product Specifications

Product Name Alternative

FSG1, FRG1A

UniProt

Q14331

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004468.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WWTVTNFGEISGTIAIEMDKGTYIHALDNGLFTLGAPHKEVDEGPSPPEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6330407J23Rik sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3214704 1.0 µg DNA

6330407J23Rik sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Dematin (DMTN) (NM_001114135) Human Tagged ORF Clone
RG225632 10 µg

Dematin (DMTN) (NM_001114135) Human Tagged ORF Clone

Sign In for Pricing
View Details
Psmd9 (NM_130430) Rat Tagged Lenti ORF Clone
RR202848L4 10 µg

Psmd9 (NM_130430) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
5-[4'-Hydroxymethyl- (1,1'-biphenyl) -2-yl]-1-triphenylmethyltetrazole
sc-210253 25 mg

5-[4'-Hydroxymethyl- (1,1'-biphenyl) -2-yl]-1-triphenylmethyltetrazole

Sign In for Pricing
View Details
ATP6E1 Lentiviral Activation Particles (m)
sc-428998-LAC 200 µL

ATP6E1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Mouse Monoclonal Glutathione Peroxidase 4/GPX4 Antibody (LHM 2)
NBP3-07344-100ug 100 µg

Mouse Monoclonal Glutathione Peroxidase 4/GPX4 Antibody (LHM 2)

Sign In for Pricing
View Details