What is the catalog number for FRG1 Peptide - middle region?

The catalog number for FRG1 Peptide - middle region is orb1998277.

What sizes are available for FRG1 Peptide - middle region?

FRG1 Peptide - middle region is available in the following size(s): 100 µg.

Is FRG1 Peptide - middle region in stock?

FRG1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

FRG1 Peptide - middle region

Product Specifications

Product Name Alternative

FSG1, FRG1A

UniProt

Q14331

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004468.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WWTVTNFGEISGTIAIEMDKGTYIHALDNGLFTLGAPHKEVDEGPSPPEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAF2960 10 / PCK

Yellow Hi-Vis Waistcoat Velcro Fastening Size Large

Sign In for Pricing

View Details

E11-202984 100 µg -100 µL

KPYR Polyclonal Antibody

Sign In for Pricing

View Details

A53145-100 100 µL

Tpsab1 Polyclonal Antibody

Sign In for Pricing

View Details

34704166 1.0 µg

Olr812 AAV siRNA Pooled Vector

Sign In for Pricing

View Details

NBP1-76380MFV500 0.1 mL

Rabbit Polyclonal Lgi4 Antibody [mFluor Violet 500 SE]

Sign In for Pricing

View Details

47093096 4x 500 ng

Tmem79-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing

View Details