Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TACC1 Peptide - middle region

TACC1 Peptide - middle region

Product Specifications

Product Name Alternative

Ga55

UniProt

O75410

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001116296.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EQPTDPVARDGPLSQTSSKPDPSQWESPSFNPFGSHSVLQNSPPLSSEGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

beta 2 Microglobulin (B2M) Mouse Monoclonal Antibody [Clone ID: D3A2]
AM09265PU-N 500 µg

beta 2 Microglobulin (B2M) Mouse Monoclonal Antibody [Clone ID: D3A2]

Sign In for Pricing
View Details
TMEM97 Human Gene Knockout Kit (CRISPR)
KN216927BN 1 Kit

TMEM97 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1X Tris-Glycine (TG) Buffer, Ultra Pure Grade, 1L
PB1410-1L 1 L

1X Tris-Glycine (TG) Buffer, Ultra Pure Grade, 1L

Sign In for Pricing
View Details
4-Pentyn-1-ol
TRC-P227540-5G 5 g

4-Pentyn-1-ol

Sign In for Pricing
View Details
IFluor® 633 maleimide
1056-AAT 1 mg

IFluor® 633 maleimide

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2618), Biotin conjugate, 0.1mg/mL
BNCB2618-500 1x 500 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2618), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details