Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TACC1 Peptide - middle region

TACC1 Peptide - middle region

Product Specifications

Product Name Alternative

Ga55

UniProt

O75410

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001116296.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EQPTDPVARDGPLSQTSSKPDPSQWESPSFNPFGSHSVLQNSPPLSSEGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
BNC700977-100 1x 100 µL

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD55 (NM_001114752) Human Over-expression Lysate
LY426508 100 µg

CD55 (NM_001114752) Human Over-expression Lysate

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
BNC740391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Inosine 5’ Triphosphate Trisodium Salt
TRC-I665000-1G 1 g

Inosine 5’ Triphosphate Trisodium Salt

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09812R-01 20 Tests

Elab Fluor® Violet 500 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09812R-02 100 Tests

Elab Fluor® Violet 500 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details