Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLK1 Peptide - middle region

TLK1 Peptide - middle region

Product Specifications

Product Name Alternative

PKU-beta

UniProt

Q9UKI8

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001130026.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RKLLAKRKPPTANNSQAPSTNSEPKQRKNKAVNGAENDPFVRPNLPQLLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PON2 Antibody
KC-3281-01 50 μL

PON2 Antibody

Sign In for Pricing
View Details
PON2 Antibody
KC-3281-02 100 µL

PON2 Antibody

Sign In for Pricing
View Details
PON2 Antibody
KC-3281-03 1 mL

PON2 Antibody

Sign In for Pricing
View Details
HHAT Human Gene Knockout Kit (CRISPR)
KN208447RB 1 Kit

HHAT Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PLAGL1 (NM_001080956) Human Over-expression Lysate
LY421140 100 µg

PLAGL1 (NM_001080956) Human Over-expression Lysate

Sign In for Pricing
View Details
EGFR pSer1046 Rabbit Polyclonal Antibody
AP01890PU-N 100 µg

EGFR pSer1046 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details