Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLK1 Peptide - middle region

TLK1 Peptide - middle region

Product Specifications

Product Name Alternative

PKU-beta

UniProt

Q9UKI8

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001130026.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RKLLAKRKPPTANNSQAPSTNSEPKQRKNKAVNGAENDPFVRPNLPQLLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Myoblast Determination Protein 1 Antibody
RC-15546-01 50 μL

Recombinant Myoblast Determination Protein 1 Antibody

Sign In for Pricing
View Details
Recombinant Myoblast Determination Protein 1 Antibody
RC-15546-02 100 µL

Recombinant Myoblast Determination Protein 1 Antibody

Sign In for Pricing
View Details
Recombinant Myoblast Determination Protein 1 Antibody
RC-15546-03 1 mL

Recombinant Myoblast Determination Protein 1 Antibody

Sign In for Pricing
View Details
PASD5 (NPAS1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C9]
TA809616AM 100 µL

PASD5 (NPAS1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C9]

Sign In for Pricing
View Details
STAT6 Recombinant Rabbit Monoclonal Antibody [SY02-72]
ET1607-61 100 µL

STAT6 Recombinant Rabbit Monoclonal Antibody [SY02-72]

Sign In for Pricing
View Details
Pseudomonas aeruginosa serotype 6C (1200/472), CF640R conjugate, 0.1mg/mL
BNC400240-100 1x 100 µL

Pseudomonas aeruginosa serotype 6C (1200/472), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details