MED8 Peptide - middle region
MED8 Peptide - middle region
Product Specifications
Product Name Alternative
ARC32
UniProt
Q96G25
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001001653.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NALVAAVAFGKGLSNWRPSGSSGPGQAGQPGAGTILAGTSGLQQVQMAGA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB0376-100 1x 100 µL
Beta Catenin (p120) (Rabbit PAb), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-MSEL-M0065-01 24 Tests
Mini Sample Mouse ESM1 (Endothelial Cell Specific Molecule 1) ELISA Kit
Sign In for Pricing
View Details E-MSEL-M0065-02 48 Tests
Mini Sample Mouse ESM1 (Endothelial Cell Specific Molecule 1) ELISA Kit
Sign In for Pricing
View Details E-MSEL-M0065-03 96 Tests
Mini Sample Mouse ESM1 (Endothelial Cell Specific Molecule 1) ELISA Kit
Sign In for Pricing
View Details 