Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED8 Peptide - middle region

MED8 Peptide - middle region

Product Specifications

Product Name Alternative

ARC32

UniProt

Q96G25

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001001653.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NALVAAVAFGKGLSNWRPSGSSGPGQAGQPGAGTILAGTSGLQQVQMAGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB1A Goat Polyclonal Antibody
AB7818-200 600 µg

RAB1A Goat Polyclonal Antibody

Sign In for Pricing
View Details
Med10 (BC056438) Mouse Tagged ORF Clone
MG200806 10 µg

Med10 (BC056438) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human DERL3 activation kit by CRISPRa
GA114103 1 Kit

Human DERL3 activation kit by CRISPRa

Sign In for Pricing
View Details
Neutravidin Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS
MG21F-NA 10x 96 Well Plates

Neutravidin Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS

Sign In for Pricing
View Details
2-(tert-Butoxycarbonyloxyimino)phenylacetonitrile
TRC-B690594-5G 5 g

2-(tert-Butoxycarbonyloxyimino)phenylacetonitrile

Sign In for Pricing
View Details
Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C6]
TA504739AM 100 µL

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C6]

Sign In for Pricing
View Details