SNRK Peptide - middle region
SNRK Peptide - middle region
Product Specifications
Product Name Alternative
HSNFRK
UniProt
Q9NRH2
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001094064.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KLSRLKMNIASPGTVHKRYHRRKSQGRGSSCSSSETSDDDSESRRRLDKD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4316804 1.0 µg DNA
Itprip sgRNA CRISPR Lentivector (Mouse) (Target 3)
Sign In for Pricing
View Details 
32106-05161 5x 30 µg
Human GBA3 AssayLite™ Antibody (APC Conjugate)
Sign In for Pricing
View Details C2404-71B-ML490 100 µL
CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4) (MaxLight 490) discontinued
Sign In for Pricing
View Details