Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNRK Peptide - middle region

SNRK Peptide - middle region

Product Specifications

Product Name Alternative

HSNFRK

UniProt

Q9NRH2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001094064.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLSRLKMNIASPGTVHKRYHRRKSQGRGSSCSSSETSDDDSESRRRLDKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Annexin A2 (ANXA2) ELISA Kit
RK00900 96 Tests

Human Annexin A2 (ANXA2) ELISA Kit

Sign In for Pricing
View Details
PPID (Peptidylprolyl Isomerase D, CYP-40, CYPD, MGC33096) (FITC)
MBS6178767-01 0.1 mL

PPID (Peptidylprolyl Isomerase D, CYP-40, CYPD, MGC33096) (FITC)

Sign In for Pricing
View Details
PPID (Peptidylprolyl Isomerase D, CYP-40, CYPD, MGC33096) (FITC)
MBS6178767-02 5x 0.1 mL

PPID (Peptidylprolyl Isomerase D, CYP-40, CYPD, MGC33096) (FITC)

Sign In for Pricing
View Details
SRC Kinase Substrate Peptide
abx265599-01 1 mg

SRC Kinase Substrate Peptide

Sign In for Pricing
View Details
SRC Kinase Substrate Peptide
abx265599-02 5 mg

SRC Kinase Substrate Peptide

Sign In for Pricing
View Details
SRC Kinase Substrate Peptide
abx265599-03 10 mg

SRC Kinase Substrate Peptide

Sign In for Pricing
View Details