Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFXAP Peptide - middle region

RFXAP Peptide - middle region

Product Specifications

UniProt

O00287

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000529.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGSGGGSMSKTCTYEGCSETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LFA3 Antibody
MBS9413811-01 0.05 mL

LFA3 Antibody

Sign In for Pricing
View Details
LFA3 Antibody
MBS9413811-02 0.1 mL

LFA3 Antibody

Sign In for Pricing
View Details
LFA3 Antibody
MBS9413811-03 5x 0.1 mL

LFA3 Antibody

Sign In for Pricing
View Details
WNK1 Antibody
ABD7022 100 µg

WNK1 Antibody

Sign In for Pricing
View Details
Recombinant Hepatitis C HCV NS3 Genotype-1b Protein, GST, E.coli-100ug
QP14027-100ug 100ug

Recombinant Hepatitis C HCV NS3 Genotype-1b Protein, GST, E.coli-100ug

Sign In for Pricing
View Details
GIRK2 Antibody / G protein activated inward rectifier potassium channel 2
V4839-20UG 20 µg

GIRK2 Antibody / G protein activated inward rectifier potassium channel 2

Sign In for Pricing
View Details