Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFXAP Peptide - middle region

RFXAP Peptide - middle region

Product Specifications

UniProt

O00287

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000529.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGSGGGSMSKTCTYEGCSETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYCS ELISA Kit (Human)
OKCD06557-96W 96 Well

CYCS ELISA Kit (Human)

Sign In for Pricing
View Details
Cilp2-set siRNA/shRNA/RNAi Lentivector (Rat)
16193096 4x 500 ng

Cilp2-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
GPAT3 Rabbit Polyclonal Antibody
orb580979 100 µL

GPAT3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chebulagic acid
TQ0180-01 1 mg

Chebulagic acid

Sign In for Pricing
View Details
Chebulagic acid
TQ0180-02 5 mg

Chebulagic acid

Sign In for Pricing
View Details
Chebulagic acid
TQ0180-03 10 mg

Chebulagic acid

Sign In for Pricing
View Details