MCRS1 Peptide - N-terminal region
MCRS1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
P78, MCRS2, MSP58, INO80Q, ICP22BP
UniProt
Q96EZ8
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001012300.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SEDEESLAGQKRASSQALGTIPKRRSSSRFIKRKKFDDELVESSLAKSST
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
36114064 1.0 µg DNA
PCDH8 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
CA533-SI 3 µm
Caprisil silica HPLC Column, 3 µm, 100 Å, CA533-SI x 50 mm
Sign In for Pricing
View Details 
16922064 1.0 µg DNA
CSGALNACT2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 