Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCRS1 Peptide - N-terminal region

MCRS1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P78, MCRS2, MSP58, INO80Q, ICP22BP

UniProt

Q96EZ8

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001012300.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SEDEESLAGQKRASSQALGTIPKRRSSSRFIKRKKFDDELVESSLAKSST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAAF1 CRISPR Activation Plasmid (h2)
sc-413366-ACT-2 20 µg

PAAF1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
IFITM5 Human shRNA Plasmid Kit (Locus ID 387733)
TR315338 1 Kit

IFITM5 Human shRNA Plasmid Kit (Locus ID 387733)

Sign In for Pricing
View Details
LIX1 Lentiviral Activation Particles (m2)
sc-426125-LAC-2 200 µL

LIX1 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
DR5 antibody (biotin)
61R-1609 100 ug

DR5 antibody (biotin)

Sign In for Pricing
View Details
PDGFD Rabbit Polyclonal Antibody
orb2952850-01 50 µg

PDGFD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PDGFD Rabbit Polyclonal Antibody
orb2952850-02 100 µg

PDGFD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details