Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPO5 Peptide - middle region

IPO5 Peptide - middle region

Product Specifications

Product Name Alternative

IMB3, Pse1, imp5, KPNB3, RANBP5

UniProt

O00410

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002262.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RKHTNIVAQTIPQMLAMMVDLEEDEDWANADELEDDDFDSNAVAGESALD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stearic Acid-1-13C
TRC-S686500-10MG 10 mg

Stearic Acid-1-13C

Sign In for Pricing
View Details
N,N’-(Ethylenedioxy)di-phthalimide
TRC-E917765-250MG 250 mg

N,N’-(Ethylenedioxy)di-phthalimide

Sign In for Pricing
View Details
3-Hydroxydodecanedioic Acid
TRC-H939615-10MG 10 mg

3-Hydroxydodecanedioic Acid

Sign In for Pricing
View Details
beta Arrestin 1 (ARRB1) Human Gene Knockout Kit (CRISPR)
KN201279 1 Kit

beta Arrestin 1 (ARRB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GRIA1 (NM_001114183) Human Over-expression Lysate
LY426474 100 µg

GRIA1 (NM_001114183) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Serpina1d activation kit by CRISPRa
GA204053 1 Kit

Mouse Serpina1d activation kit by CRISPRa

Sign In for Pricing
View Details