Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF5A2 Peptide - middle region

EIF5A2 Peptide - middle region

Product Specifications

Product Name Alternative

EIF-5A2, eIF5AII

UniProt

Q9GZV4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_065123.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYA

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD134/OX40L Recepter Rabbit pAb
orb2714662-01 50 µL

CD134/OX40L Recepter Rabbit pAb

Sign In for Pricing
View Details
CD134/OX40L Recepter Rabbit pAb
orb2714662-02 100 µL

CD134/OX40L Recepter Rabbit pAb

Sign In for Pricing
View Details
TGIF2 (TGFB-Induced Factor Homeobox 2) (HRP)
MBS6181474-01 0.1 mL

TGIF2 (TGFB-Induced Factor Homeobox 2) (HRP)

Sign In for Pricing
View Details
TGIF2 (TGFB-Induced Factor Homeobox 2) (HRP)
MBS6181474-02 5x 0.1 mL

TGIF2 (TGFB-Induced Factor Homeobox 2) (HRP)

Sign In for Pricing
View Details
RASSF2 Rabbit Polyclonal Antibody
orb589817 100 µL

RASSF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CTBP2 Mouse Monoclonal Antibody (Biotin)
orb2591195 100 µg

CTBP2 Mouse Monoclonal Antibody (Biotin)

Sign In for Pricing
View Details