Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA3 Peptide - middle region

PSMA3 Peptide - middle region

Product Specifications

Product Name Alternative

HC8, PSC3

UniProt

P25788

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002779.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tau (MAPT) Rabbit Monoclonal Antibody [Clone ID: OTIR10C1]
TA592889 100 µL

Tau (MAPT) Rabbit Monoclonal Antibody [Clone ID: OTIR10C1]

Sign In for Pricing
View Details
RNA5-8SN2 Mouse Monoclonal Antibody [Clone ID: OTI1C8]
CF811327 100 µg

RNA5-8SN2 Mouse Monoclonal Antibody [Clone ID: OTI1C8]

Sign In for Pricing
View Details
Purified Anti-Human CD14 Antibody[H332-1B10]
AN002130P-01 25 µg

Purified Anti-Human CD14 Antibody[H332-1B10]

Sign In for Pricing
View Details
Purified Anti-Human CD14 Antibody[H332-1B10]
AN002130P-02 100 µg

Purified Anti-Human CD14 Antibody[H332-1B10]

Sign In for Pricing
View Details
CD4 (C4/206), CF405S conjugate, 0.1mg/mL
BNC040206-100 1x 100 µL

CD4 (C4/206), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ccl7 Mouse Gene Knockout Kit (CRISPR)
KN502797 1 Kit

Ccl7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details