Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA3 Peptide - middle region

PSMA3 Peptide - middle region

Product Specifications

Product Name Alternative

HC8, PSC3

UniProt

P25788

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002779.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atpif1 (NM_007512) Mouse Tagged ORF Clone
MG200378 10 µg

Atpif1 (NM_007512) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Carboxyamidotriazole
TRC-C177775-50MG 50 mg

Carboxyamidotriazole

Sign In for Pricing
View Details
PCR Cabinet BPCR-203
BPCR-203 1 Unit

PCR Cabinet BPCR-203

Sign In for Pricing
View Details
Frozen Tissue Sections, Artery
CS626568 5x 5 µm

Frozen Tissue Sections, Artery

Sign In for Pricing
View Details
CytoLinerTM 410/450 Fixed Cell Membrane Stain, 250 labelings
#30131-T 1 Kit

CytoLinerTM 410/450 Fixed Cell Membrane Stain, 250 labelings

Sign In for Pricing
View Details
3-Hydroxy-2,7-naphthalenedisulfonic Acid Sodium Salt > 90%
TRC-H950745-10G 10 g

3-Hydroxy-2,7-naphthalenedisulfonic Acid Sodium Salt > 90%

Sign In for Pricing
View Details