Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFIP11 Peptide - N-terminal region

TFIP11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NTR1, STIP, TIP39, STIP-1, Spp382, bK445C9.6

UniProt

Q9UBB9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001008697.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VWAERDSDDERPSFGGKRARDYSAPVNFISAGLKKGAAEEAELEDSDDEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bilirubin (>90%)
TRC-B385300-500MG 500 mg

Bilirubin (>90%)

Sign In for Pricing
View Details
Mixture of S077210 (150mL of 1mg/mL S077210 in a 0.9% (Sodium Chloride) NaCl solution)
TRC-CMIX016-150ML 150 mL

Mixture of S077210 (150mL of 1mg/mL S077210 in a 0.9% (Sodium Chloride) NaCl solution)

Sign In for Pricing
View Details
GCIP interacting protein p29 (SYF2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A5]
TA808453AM 100 µL

GCIP interacting protein p29 (SYF2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A5]

Sign In for Pricing
View Details
Phosphotyrosine (PY20), CF640R conjugate, 0.1mg/mL
BNC400232-100 1x 100 µL

Phosphotyrosine (PY20), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Crude Mangifera indica Lectin (Mango) -MIA-
L-6000-100 100 mg

Crude Mangifera indica Lectin (Mango) -MIA-

Sign In for Pricing
View Details
DFNA5 / GSDME Recombinant Rabbit monoclonal Antibody
HA751376 100 µL

DFNA5 / GSDME Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details