Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFIP11 Peptide - N-terminal region

TFIP11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NTR1, STIP, TIP39, STIP-1, Spp382, bK445C9.6

UniProt

Q9UBB9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001008697.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VWAERDSDDERPSFGGKRARDYSAPVNFISAGLKKGAAEEAELEDSDDEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tricyclene
TRC-T797465-25MG 25 mg

Tricyclene

Sign In for Pricing
View Details
Human TOGARAM2 activation kit by CRISPRa
GA116124 1 Kit

Human TOGARAM2 activation kit by CRISPRa

Sign In for Pricing
View Details
Vta1 Mouse Gene Knockout Kit (CRISPR)
KN519288 1 Kit

Vta1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FBXO3 (NM_012175) Human Recombinant Protein
TP308494M 100 µg

FBXO3 (NM_012175) Human Recombinant Protein

Sign In for Pricing
View Details
NUP88 (NM_002532) Human Over-expression Lysate
LC419266 20 µg

NUP88 (NM_002532) Human Over-expression Lysate

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD103 Antibody[M290]
E-AB-F1090I-01 50 Tests

PE/Cyanine5.5 Anti-Mouse CD103 Antibody[M290]

Sign In for Pricing
View Details