Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK19 Peptide - N-terminal region

STK19 Peptide - N-terminal region

Product Specifications

Product Name Alternative

G11, RP1, D6S60, D6S60E, HLA-RP1

UniProt

P49842

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004188.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QKWFSAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tacr1 (393-407) Rabbit Polyclonal Antibody
20060 100 µL

Tacr1 (393-407) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MHC II, Mouse (MK-D6), CF594 conjugate, 0.1mg/mL
BNC942007-100 1x 100 µL

MHC II, Mouse (MK-D6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS804264 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Mouse Smpd1 activation kit by CRISPRa
GA203986 1 Kit

Mouse Smpd1 activation kit by CRISPRa

Sign In for Pricing
View Details
COL23A1 Human Gene Knockout Kit (CRISPR)
KN420535 1 Kit

COL23A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GALNT17 (NM_022479) Human Over-expression Lysate
LC402927 20 µg

GALNT17 (NM_022479) Human Over-expression Lysate

Sign In for Pricing
View Details