Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK19 Peptide - N-terminal region

STK19 Peptide - N-terminal region

Product Specifications

Product Name Alternative

G11, RP1, D6S60, D6S60E, HLA-RP1

UniProt

P49842

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004188.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QKWFSAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5,6-trans-Vitamin D3, ~90%
TRC-V676065-25MG 25 mg

5,6-trans-Vitamin D3, ~90%

Sign In for Pricing
View Details
HBLD1 (ISCA2) (Center) Rabbit Polyclonal Antibody
AP52242PU-N 400 µL

HBLD1 (ISCA2) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Cdk5 activation kit by CRISPRa
GA200671 1 Kit

Mouse Cdk5 activation kit by CRISPRa

Sign In for Pricing
View Details
p16INK4A (CDKN2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H5]
TA805237AM 100 µL

p16INK4A (CDKN2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H5]

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), Biotin conjugate, 0.1mg/mL
BNCB1798-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
6-Ethyl Guanine-d5
TRC-E918652-5MG 5 mg

6-Ethyl Guanine-d5

Sign In for Pricing
View Details