Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPP2 Peptide - middle region

TPP2 Peptide - middle region

Product Specifications

Product Name Alternative

TPP-2, TPPII

UniProt

P29144

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003282.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKTELGKKADVIPVHYYLIPPPTKTKNGSKDKEKDSEKEKDLKEEFTEAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Prolylcarboxypeptidase (PRCP)
TRV-0004902-01 10 µg

Recombinant Prolylcarboxypeptidase (PRCP)

Sign In for Pricing
View Details
Recombinant Prolylcarboxypeptidase (PRCP)
TRV-0004902-02 50 µg

Recombinant Prolylcarboxypeptidase (PRCP)

Sign In for Pricing
View Details
Recombinant Prolylcarboxypeptidase (PRCP)
TRV-0004902-03 100 µg

Recombinant Prolylcarboxypeptidase (PRCP)

Sign In for Pricing
View Details
Recombinant Prolylcarboxypeptidase (PRCP)
TRV-0004902-04 200 µg

Recombinant Prolylcarboxypeptidase (PRCP)

Sign In for Pricing
View Details
Recombinant Prolylcarboxypeptidase (PRCP)
TRV-0004902-05 500 µg

Recombinant Prolylcarboxypeptidase (PRCP)

Sign In for Pricing
View Details
Recombinant Prolylcarboxypeptidase (PRCP)
TRV-0004902-06 1 mg

Recombinant Prolylcarboxypeptidase (PRCP)

Sign In for Pricing
View Details