Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM43 Peptide - N-terminal region

TMEM43 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LUMA, ARVC5, ARVD5, EDMD7

UniProt

Q9BTV4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_077310.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ANYSSTSTRREHVKVKTSSQPGFLERLSETSGGMFVGLMAFLLSFYLIFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbx1 Mouse shRNA Plasmid (Locus ID 56438)
TR519178 1 Kit

Rbx1 Mouse shRNA Plasmid (Locus ID 56438)

Sign In for Pricing
View Details
HMGN2P31 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV728290 1.0 µg DNA

HMGN2P31 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
(S) -2-Amino-2- (3,5-di-tert-butylphenyl) ethan-1-ol hydrochloride
OR1065846-01 100 mg

(S) -2-Amino-2- (3,5-di-tert-butylphenyl) ethan-1-ol hydrochloride

Sign In for Pricing
View Details
(S) -2-Amino-2- (3,5-di-tert-butylphenyl) ethan-1-ol hydrochloride
OR1065846-02 250 mg

(S) -2-Amino-2- (3,5-di-tert-butylphenyl) ethan-1-ol hydrochloride

Sign In for Pricing
View Details
(S) -2-Amino-2- (3,5-di-tert-butylphenyl) ethan-1-ol hydrochloride
OR1065846-03 1 g

(S) -2-Amino-2- (3,5-di-tert-butylphenyl) ethan-1-ol hydrochloride

Sign In for Pricing
View Details
WDR4 (WD Repeat-containing Protein 4, tRNA (Guanine-N (7) -) -methyltransferase Subunit WDR4, TRM82, TRMT82) (MaxLight 490)
135349-ML490 100 µL

WDR4 (WD Repeat-containing Protein 4, tRNA (Guanine-N (7) -) -methyltransferase Subunit WDR4, TRM82, TRMT82) (MaxLight 490)

Sign In for Pricing
View Details