What is the catalog number for TMEM43 Peptide - N-terminal region?

The catalog number for TMEM43 Peptide - N-terminal region is orb1998249.

What sizes are available for TMEM43 Peptide - N-terminal region?

TMEM43 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is TMEM43 Peptide - N-terminal region in stock?

TMEM43 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

TMEM43 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LUMA, ARVC5, ARVD5, EDMD7

UniProt

Q9BTV4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_077310.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ANYSSTSTRREHVKVKTSSQPGFLERLSETSGGMFVGLMAFLLSFYLIFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AM50301PU-S 100 µg

EMA (MUC1) Mouse Monoclonal Antibody [Clone ID: GP1.4 + E29]

Sign In for Pricing

View Details

GA204274 1 Kit

Mouse Phf1 activation kit by CRISPRa

Sign In for Pricing

View Details

orb1052754 100 µL

Visfatin Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing

View Details

MBS108968 Inquire

Plant Papaya Proteinase I (PPI) ELISA Kit

Sign In for Pricing

View Details

010956 5 mg

Dothiepin

Sign In for Pricing

View Details

42199126 3x 1.0µg DNA

RPS19 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing

View Details