Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAH Peptide - middle region

PAH Peptide - middle region

Product Specifications

Product Name Alternative

AW106920

UniProt

P16331

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032803.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYTEEERKTWGTVFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Methyl-4-nitro-5-propyl-1H-pyrazole-3-carboxamide
017039 10 mg

1-Methyl-4-nitro-5-propyl-1H-pyrazole-3-carboxamide

Sign In for Pricing
View Details
Mouse Melanoma-Associated Antigen, clone KBA.62 (Monoclonal) Antibody
orb302200 1 mL

Mouse Melanoma-Associated Antigen, clone KBA.62 (Monoclonal) Antibody

Sign In for Pricing
View Details
Tau Mouse mAb
orb1924411-01 50 µL

Tau Mouse mAb

Sign In for Pricing
View Details
Tau Mouse mAb
orb1924411-02 100 µL

Tau Mouse mAb

Sign In for Pricing
View Details
LIMM Protein Vector (Human) (pPM-C-His)
PV090881 500 ng

LIMM Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Nup53 (NUP35) Human Over-expression Lysate
orb1372862 20 µg

Nup53 (NUP35) Human Over-expression Lysate

Sign In for Pricing
View Details