Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAH Peptide - middle region

PAH Peptide - middle region

Product Specifications

Product Name Alternative

AW106920

UniProt

P16331

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032803.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYTEEERKTWGTVFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OOEP Antibody
MBS9435444-01 0.05 mL

OOEP Antibody

Sign In for Pricing
View Details
OOEP Antibody
MBS9435444-02 0.1 mL

OOEP Antibody

Sign In for Pricing
View Details
OOEP Antibody
MBS9435444-03 5x 0.1 mL

OOEP Antibody

Sign In for Pricing
View Details
Arp3 rabbit pAb Antibody
orb764582-01 50 μL

Arp3 rabbit pAb Antibody

Sign In for Pricing
View Details
Arp3 rabbit pAb Antibody
orb764582-02 100 µL

Arp3 rabbit pAb Antibody

Sign In for Pricing
View Details
DKFZP434K028 ORF Vector (Human) (pORF)
ORF003131 1.0 µg DNA

DKFZP434K028 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details