Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDK1 Peptide - middle region

PDK1 Peptide - middle region

Product Specifications

Product Name Alternative

B830012B01, D530020C15Rik

UniProt

Q8BFP9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_766253.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QYFLDRFYMSRISIRMLLNQHSLLFGGKGSPSHRKHIGSINPNCDVVEVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iba1 Recombinant Chimeric Antibody Antibody
HA610214 100 µg

Iba1 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
PKR (EIF2AK2) Rabbit Polyclonal Antibody
AP02776PU-S 50 µL

PKR (EIF2AK2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
6,6’-Dibromoindigo
TRC-D270675-500MG 500 mg

6,6’-Dibromoindigo

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD15/SSEA-1 Antibody[HI98]
E-AB-F1079J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD15/SSEA-1 Antibody[HI98]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD15/SSEA-1 Antibody[HI98]
E-AB-F1079J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD15/SSEA-1 Antibody[HI98]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD15/SSEA-1 Antibody[HI98]
E-AB-F1079J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Human CD15/SSEA-1 Antibody[HI98]

Sign In for Pricing
View Details